PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G18230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 269aa    MW: 30811 Da    PI: 7.3757
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G18230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.2e-53101391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+e+d++k+ePwdL+   ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+
  OGLUM06G18230.1  10 VPPGFRFHPTDEELLYYYLRKKVAYEAIDL-DVIREIDLNKLEPWDLKDrcRIGTgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKA 102
                      69****************************.9***************943444442456*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++ ++   +g++ktLvfy grap+g+ktdW+mheyrl
  OGLUM06G18230.1 103 IFLANACRIGMRKTLVFYVGRAPHGKKTDWIMHEYRL 139
                      ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-595159IPR003441NAC domain
PROSITE profilePS5100557.15410159IPR003441NAC domain
PfamPF023655.2E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MHPSGGVLSV PPGFRFHPTD EELLYYYLRK KVAYEAIDLD VIREIDLNKL EPWDLKDRCR  60
IGTGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIFLANACR IGMRKTLVFY  120
VGRAPHGKKT DWIMHEYRLD QDNVDVQEDG WVVCRVFMKK SYQRGLNPAD MAAVDDDDLL  180
LHHHHPFPPA QLHGGAADHK HDGAGGHHHH HLMQPHHHYD DFPSFDPSMQ LPQLMSADQP  240
PPPPPSLLPG RLPLQYLGCE AADLLRFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-51816115167NO APICAL MERISTEM PROTEIN
1ut4_B5e-51816115167NO APICAL MERISTEM PROTEIN
1ut7_A5e-51816115167NO APICAL MERISTEM PROTEIN
1ut7_B5e-51816115167NO APICAL MERISTEM PROTEIN
3swm_A6e-51816118170NAC domain-containing protein 19
3swm_B6e-51816118170NAC domain-containing protein 19
3swm_C6e-51816118170NAC domain-containing protein 19
3swm_D6e-51816118170NAC domain-containing protein 19
3swp_A6e-51816118170NAC domain-containing protein 19
3swp_B6e-51816118170NAC domain-containing protein 19
3swp_C6e-51816118170NAC domain-containing protein 19
3swp_D6e-51816118170NAC domain-containing protein 19
4dul_A5e-51816115167NAC domain-containing protein 19
4dul_B5e-51816115167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281860.0AB028186.1 Oryza sativa mRNA for OsNAC7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644283.10.0PREDICTED: NAC domain-containing protein 76
SwissprotQ5Z6B61e-158NAC76_ORYSJ; NAC domain-containing protein 76
TrEMBLA0A0E0AAF90.0A0A0E0AAF9_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g33940.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.34e-88NAC family protein